PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G18710.1
Common NameAtMYB47, F6a14.18, MYB47
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 267aa    MW: 30592.3 Da    PI: 5.4615
Description myb domain protein 47
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G18710.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd++l  +++++G  +W++ +++ g+ R++k+c++rw++yl
      AT1G18710.1 14 KGEWTAEEDQKLGAYINEHGVCDWRSLPKRAGLQRCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding54.52.6e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++E+e ++++++ lG++ W++ a++m+ +Rt++++k++w++ 
      AT1G18710.1  67 RGKFTPQEEEEIIQLHAVLGNR-WAAMAKKMQ-NRTDNDIKNHWNSC 111
                      89********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.398961IPR017930Myb domain
SuperFamilySSF466892.31E-2811108IPR009057Homeodomain-like
SMARTSM007173.3E-121363IPR001005SANT/Myb domain
PfamPF002493.0E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-231568IPR009057Homeodomain-like
CDDcd001672.38E-91661No hitNo description
PROSITE profilePS5129425.14262116IPR017930Myb domain
SMARTSM007174.3E-1566114IPR001005SANT/Myb domain
PfamPF002496.7E-1667111IPR001005SANT/Myb domain
CDDcd001671.03E-969109No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2469116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009025anatomyvascular leaf
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRTTWFDVD GMKKGEWTAE EDQKLGAYIN EHGVCDWRSL PKRAGLQRCG KSCRLRWLNY  60
LKPGIRRGKF TPQEEEEIIQ LHAVLGNRWA AMAKKMQNRT DNDIKNHWNS CLKKRLSRKG  120
IDPMTHEPII KHLTVNTTNA DCGNSSTTTS PSTTESSPSS GSSRLLNKLA AGISSRQHSL  180
DRIKYILSNS IIESSDQAKE EEEKEEEEEE RDSMMGQKID GSEGEDIQIW GEEEVRRLME  240
IDAMDMYEMT SYDAVMYESS HILDHLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2591162108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261431_at0.0
Expression AtlasAT1G18710-
AtGenExpressAT1G18710-
ATTED-IIAT1G18710-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G18710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDjasmonic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G18710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0651660.0AY065166.1 Arabidopsis thaliana Putative MYB47 transcription factor (F6a14.18) mRNA, complete cds.
GenBankAY1145790.0AY114579.1 Arabidopsis thaliana Putative MYB47 transcription factor (At1g18710) mRNA, complete cds.
GenBankAY5195560.0AY519556.1 Arabidopsis thaliana MYB transcription factor (At1g18710) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173306.10.0myb domain protein 47
SwissprotO643991e-59MYB34_ARATH; Transcription factor MYB34
TrEMBLQ9M9U20.0Q9M9U2_ARATH; MYB transcription factor
STRINGAT1G18710.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP
    Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light.
    Plant J., 2003. 36(2): p. 203-14
    [PMID:14535885]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Koroleva OA,Tomlinson ML,Leader D,Shaw P,Doonan JH
    High-throughput protein localization in Arabidopsis using Agrobacterium-mediated transient expression of GFP-ORF fusions.
    Plant J., 2005. 41(1): p. 162-74
    [PMID:15610358]
  6. Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S
    Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis.
    J. Agric. Food Chem., 2005. 53(4): p. 1022-30
    [PMID:15713015]
  7. Osakabe Y, et al.
    Leucine-rich repeat receptor-like kinase1 is a key membrane-bound regulator of abscisic acid early signaling in Arabidopsis.
    Plant Cell, 2005. 17(4): p. 1105-19
    [PMID:15772289]
  8. Devoto A, et al.
    Expression profiling reveals COI1 to be a key regulator of genes involved in wound- and methyl jasmonate-induced secondary metabolism, defence, and hormone interactions.
    Plant Mol. Biol., 2005. 58(4): p. 497-513
    [PMID:16021335]
  9. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  10. Xin Z,Mandaokar A,Chen J,Last RL,Browse J
    Arabidopsis ESK1 encodes a novel regulator of freezing tolerance.
    Plant J., 2007. 49(5): p. 786-99
    [PMID:17316173]
  11. Hern
    Impairment of cellulose synthases required for Arabidopsis secondary cell wall formation enhances disease resistance.
    Plant Cell, 2007. 19(3): p. 890-903
    [PMID:17351116]
  12. Sottosanto JB,Saranga Y,Blumwald E
    Impact of AtNHX1, a vacuolar Na+/H+ antiporter, upon gene expression during short- and long-term salt stress in Arabidopsis thaliana.
    BMC Plant Biol., 2007. 7: p. 18
    [PMID:17411438]